Zu "GeneID 7728" wurden 14 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ZNF175
Anti-ZNF175

Artikelnummer: ATA-HPA074615.100

Polyclonal Antibody against Human ZNF175, Gene description: zinc finger protein 175, Alternative Gene Names: OTK18, Validated applications: ICC, Uniprot ID: Q9Y473, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Down-regulates the expression of several...
Schlagworte: Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
477,00 €
Bewerten
Zinc finger protein 175 (ZNF175), human, recombinant
Zinc finger protein 175 (ZNF175), human, recombinant

Artikelnummer: CSB-EP026556HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-711aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MPADVNLSQK PQVLGPEKQD GSCEASVSFE DVTVDFSREE WQQLDPAQRC LYRDVMLELY SHLFAVGYHI PNPEVIFRML KEKEPRVEEA EVSHQRCQER EFGLEIPQKE ISKKASFQKD MVGEFTRDGS...
Schlagworte: ZNF175, Zinc finger protein 175, Zinc finger protein OTK18, Recombinant Human Zinc finger protein 175 (ZNF175)
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 97.6 kD
ab 219,00 €
Bewerten
Anti-ZNF175
Anti-ZNF175

Artikelnummer: G-PACO31172.50

ZNF175 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. ZNF175 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Down-regulates the expression of several chemokine receptors. Interferes with HIV-1...
Schlagworte: Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
384,00 €
Bewerten
Anti-ZNF175
Anti-ZNF175

Artikelnummer: ATA-HPA002717.100

Protein function: Down-regulates the expression of several chemokine receptors. Interferes with HIV-1 replication by suppressing Tat-induced viral LTR promoter activity. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to...
Schlagworte: Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18
Anwendung: ICC, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 239,00 €
Bewerten
ZNF175 (human), recombinant protein
ZNF175 (human), recombinant protein

Artikelnummer: ABS-PP-9525.100

Schlagworte: Zinc finger protein 175, Zinc finger protein OTK18, Recombinant Human ZNF175 Protein
MW: 16.5 kD
ab 90,00 €
Bewerten
ZNF175 PrEST Antigen
ZNF175 PrEST Antigen

Artikelnummer: ATA-APrEST95863.100

PrEST Antigen ZNF175, Gene description: zinc finger protein 175, Alternative Gene Names: OTK18, Antigen sequence: LYSHLFAVGYHIPNPEVIFRMLKEKEPRVEEAEVSHQRCQEREFGLEIPQKEISKKASFQKDMVGEFTRD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Down-regulates the expression of...
Schlagworte: ZNF175, Zinc finger protein 175, Zinc finger protein OTK18
Exprimiert in: E.coli
Ursprungsart: human
265,00 €
Bewerten
Anti-ZNF175
Anti-ZNF175

Artikelnummer: CSB-PA026556LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF175. Antigen Species: Human
Schlagworte: Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18, OTK18 antibody, Zinc finger protein 175...
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-ZNF175, FITC conjugated
Anti-ZNF175, FITC conjugated

Artikelnummer: CSB-PA026556LC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF175. Antigen Species: Human
Schlagworte: Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18, OTK18 antibody, Zinc finger protein 175...
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-ZNF175, HRP conjugated
Anti-ZNF175, HRP conjugated

Artikelnummer: CSB-PA026556LB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF175. Antigen Species: Human
Schlagworte: Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18, OTK18 antibody, Zinc finger protein 175...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-ZNF175, Biotin conjugated
Anti-ZNF175, Biotin conjugated

Artikelnummer: CSB-PA026556LD01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF175. Antigen Species: Human
Schlagworte: Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18, OTK18 antibody, Zinc finger protein 175...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
ZNF175 (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
ZNF175 (Vector Vector will be determined during the...

Artikelnummer: CSB-CL026556HU.10

Length: 2136 Sequence: atgcctgctg atgtgaattt atcccagaag cctcaggtcc tgggtccaga gaagcaggat ggatcttgcg aggcatcagt gtcatttgag gacgtgaccg tggacttcag cagggaggag tggcagcaac tggaccctgc ccagagatgc ctgtaccggg atgtgatgct ggagctctat agccatctct tcgcagtggg gtatcacatt cccaacccag aggtcatctt cagaatgcta aaagaaaagg agccgcgtgt...
Schlagworte: ZNF175, Zinc finger protein 175, Zinc finger protein OTK18
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
482,00 €
Bewerten
ZNF175, Human zinc finger protein 175, Real Time PCR Primer Set
ZNF175, Human zinc finger protein 175, Real Time PCR...

Artikelnummer: VHPS-10183

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: ZNF175, Zinc finger protein 175, Zinc finger protein OTK18
Anwendung: RNA quantification
44,00 €
Bewerten
1 von 2 Seiten