- Suchergebnis für GeneID 7728
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 7728" wurden 14 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA074615.100
Polyclonal Antibody against Human ZNF175, Gene description: zinc finger protein 175, Alternative Gene Names: OTK18, Validated applications: ICC, Uniprot ID: Q9Y473, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Down-regulates the expression of several...
Schlagworte: | Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18 |
Anwendung: | ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
477,00 €
Artikelnummer: CSB-EP026556HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-711aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MPADVNLSQK PQVLGPEKQD GSCEASVSFE DVTVDFSREE WQQLDPAQRC LYRDVMLELY SHLFAVGYHI PNPEVIFRML KEKEPRVEEA EVSHQRCQER EFGLEIPQKE ISKKASFQKD MVGEFTRDGS...
Schlagworte: | ZNF175, Zinc finger protein 175, Zinc finger protein OTK18, Recombinant Human Zinc finger protein 175 (ZNF175) |
Anwendung: | Activity not tested |
Exprimiert in: | E.coli |
Ursprungsart: | human |
MW: | 97.6 kD |
ab 219,00 €
Artikelnummer: G-PACO31172.50
ZNF175 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. ZNF175 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Down-regulates the expression of several chemokine receptors. Interferes with HIV-1...
Schlagworte: | Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18 |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
384,00 €
Artikelnummer: ATA-HPA002717.100
Protein function: Down-regulates the expression of several chemokine receptors. Interferes with HIV-1 replication by suppressing Tat-induced viral LTR promoter activity. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to...
Schlagworte: | Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18 |
Anwendung: | ICC, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 239,00 €

Artikelnummer: ABS-PP-9525.100
Schlagworte: | Zinc finger protein 175, Zinc finger protein OTK18, Recombinant Human ZNF175 Protein |
MW: | 16.5 kD |
ab 90,00 €

Artikelnummer: ATA-APrEST95863.100
PrEST Antigen ZNF175, Gene description: zinc finger protein 175, Alternative Gene Names: OTK18, Antigen sequence: LYSHLFAVGYHIPNPEVIFRMLKEKEPRVEEAEVSHQRCQEREFGLEIPQKEISKKASFQKDMVGEFTRD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Down-regulates the expression of...
Schlagworte: | ZNF175, Zinc finger protein 175, Zinc finger protein OTK18 |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €

Artikelnummer: CSB-PA026556LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF175. Antigen Species: Human
Schlagworte: | Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18, OTK18 antibody, Zinc finger protein 175... |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-PA026556LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF175. Antigen Species: Human
Schlagworte: | Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18, OTK18 antibody, Zinc finger protein 175... |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-PA026556LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF175. Antigen Species: Human
Schlagworte: | Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18, OTK18 antibody, Zinc finger protein 175... |
Anwendung: | ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-PA026556LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF175. Antigen Species: Human
Schlagworte: | Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18, OTK18 antibody, Zinc finger protein 175... |
Anwendung: | ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-CL026556HU.10
Length: 2136 Sequence: atgcctgctg atgtgaattt atcccagaag cctcaggtcc tgggtccaga gaagcaggat ggatcttgcg aggcatcagt gtcatttgag gacgtgaccg tggacttcag cagggaggag tggcagcaac tggaccctgc ccagagatgc ctgtaccggg atgtgatgct ggagctctat agccatctct tcgcagtggg gtatcacatt cccaacccag aggtcatctt cagaatgcta aaagaaaagg agccgcgtgt...
Schlagworte: | ZNF175, Zinc finger protein 175, Zinc finger protein OTK18 |
Anwendung: | Molecular biology, clone |
Spezies-Reaktivität: | human |
482,00 €

Artikelnummer: VHPS-10183
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: | ZNF175, Zinc finger protein 175, Zinc finger protein OTK18 |
Anwendung: | RNA quantification |
44,00 €