Zu "GeneID 574243" wurden 10 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
C-X-C motif chemokine 10 protein (CXCL10) (Active),...
Artikelnummer: CSB-AP001031MOW.100
Organism: Macaca mulatta (Rhesus macaque). Source: E.Coli. Expression Region: 22-98aa. Protein Length: Full Length of Mature Protein. Tag Info: Tag-Free. Target Protein Sequence: IPLSRTVRCT CISISNQPVN PRSLEKLEII PPSQFCPHVE IIATMKKKGE KRCLNPESKA IKNLLKAVSK ERSKRSP. Purity: >97% as determined by SDS-PAGE. Endotoxin:...
| Schlagworte: | IP-10, SCYB10, CXCL10, Gamma-IP10, C-X-C motif chemokine 10, Small-inducible cytokine B10, 10 kDa interferon gamma-induced... |
| Anwendung: | Active protein |
| Ursprungsart: | Rhesus macaque |
| MW: | 8.7 kD |
ab 171,00 €
C-X-C motif chemokine 10 (CXCL10), Macaca mulatta,...
Artikelnummer: CSB-EP822646MOW.1
Organism: Macaca mulatta (Rhesus macaque). Source: E.coli. Expression Region: 22-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: IPLSRTVRCT CISISNQPVN PRSLEKLEII PPSQFCPHVE IIATMKKKGE KRCLNPESKA IKNLLKAVSK ERSKRSP. Purity: Greater than 90% as...
| Schlagworte: | IP-10, SCYB10, CXCL10, Gamma-IP10, C-X-C motif chemokine 10, Small-inducible cytokine B10, 10 kDa interferon gamma-induced... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | Rhesus macaque |
| MW: | 12.7 kD |
ab 364,00 €
Anti-CXCL10
Artikelnummer: CSB-PA822646LA01MOW.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CXCL10. Antigen Species: Macaca mulatta (Rhesus macaque)
| Schlagworte: | Anti-IP-10, Anti-SCYB10, Anti-CXCL10, Anti-Gamma-IP10, Anti-C-X-C motif chemokine 10, Anti-Small-inducible cytokine B10,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Macaca mulatta |
ab 167,00 €
Anti-CXCL10, HRP conjugated
Artikelnummer: CSB-PA822646LB01MOW.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CXCL10. Antigen Species: Macaca mulatta (Rhesus macaque)
| Schlagworte: | Anti-IP-10, Anti-SCYB10, Anti-CXCL10, Anti-Gamma-IP10, Anti-C-X-C motif chemokine 10, Anti-Small-inducible cytokine B10,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Macaca mulatta |
ab 167,00 €
Anti-CXCL10, FITC conjugated
Artikelnummer: CSB-PA822646LC01MOW.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CXCL10. Antigen Species: Macaca mulatta (Rhesus macaque)
| Schlagworte: | Anti-IP-10, Anti-SCYB10, Anti-CXCL10, Anti-Gamma-IP10, Anti-C-X-C motif chemokine 10, Anti-Small-inducible cytokine B10,... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Macaca mulatta |
ab 167,00 €
Anti-CXCL10, Biotin conjugated
Artikelnummer: CSB-PA822646LD01MOW.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CXCL10. Antigen Species: Macaca mulatta (Rhesus macaque)
| Schlagworte: | Anti-IP-10, Anti-SCYB10, Anti-CXCL10, Anti-Gamma-IP10, Anti-C-X-C motif chemokine 10, Anti-Small-inducible cytokine B10,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Macaca mulatta |
ab 167,00 €
Monkey C-X-C motif chemokine 10 (CXCL10) ELISA kit
Artikelnummer: CSB-EL006240RH.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 62.5 pg/mL-4000 pg/mL Sensitivity: 15.6 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. [The...
| Schlagworte: | IP-10, SCYB10, CXCL10, Gamma-IP10, C-X-C motif chemokine 10, Small-inducible cytokine B10, 10 kDa interferon gamma-induced... |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | monkey |
ab 703,00 €
C-X-C motif chemokine 10, active (CXCL10), Recombinant,...
Artikelnummer: 347995.5
Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3 (By similarity). {ECO:0000250}. Biological Activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10- 50ng/ml....
| Schlagworte: | IP-10, SCYB10, CXCL10, Gamma-IP10, C-X-C motif chemokine 10, Small-inducible cytokine B10, 10 kDa interferon gamma-induced... |
| MW: | 8,7 |
402,00 €
Anti-CXCL10
Artikelnummer: G-PACO38206.50
CXCL10 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Macaca mulatta and for use in ELISA applications. CXCL10 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. [The UniProt Consortium]
| Schlagworte: | Anti-IP-10, Anti-SCYB10, Anti-CXCL10, Anti-Gamma-IP10, Anti-C-X-C motif chemokine 10, Anti-Small-inducible cytokine B10,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Macaca mulatta |
384,00 €
CXCL10, Recombinant, Macaca Mulatta, aa22-98, His-Tag...
Artikelnummer: 372922.100
Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. Source: Recombinant protein corresponding to aa22-98 from macaca mulatta CXCL10, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~12.7kD, AA Sequence: IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP,...
| Schlagworte: | IP-10, SCYB10, CXCL10, Gamma-IP10, C-X-C motif chemokine 10, Small-inducible cytokine B10, 10 kDa interferon gamma-induced... |
| MW: | 12,7 |
ab 651,00 €