- Suchergebnis für GeneID 5533
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 5533" wurden 19 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA074370.100
Polyclonal Antibody against Human PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma, Alternative Gene Names: CALNA3, PP2Bgamma, Validated applications: ICC, Uniprot ID: P48454, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Schlagworte: | Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
Anwendung: | ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
477,00 €
Artikelnummer: CSB-EP018574HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 2-512aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: SGRRFHLSTT DRVIKAVPFP PTQRLTFKEV FENGKPKVDV LKNHLVKEGR LEEEVALKII NDGAAILRQE KTMIEVDAPI TVCGDIHGQF FDLMKLFEVG GSPSNTRYLF LGDYVDRGYF SIECVLYLWS LKINHPKTLF...
Schlagworte: | PPP3CC, CALNA3, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent... |
Anwendung: | Activity not tested |
Exprimiert in: | E.coli |
Ursprungsart: | human |
MW: | 62 kD |
ab 219,00 €
Artikelnummer: NSJ-F40087-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation...
Schlagworte: | Anti-CALNA3, Anti-PPP3CC, EC=3.1.3.16, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic... |
Anwendung: | WB, IHC, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 350,00 €
Artikelnummer: NSJ-F40178-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation...
Schlagworte: | Anti-CALNA3, Anti-PPP3CC, EC=3.1.3.16, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic... |
Anwendung: | IHC, WB, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 350,00 €
Artikelnummer: ATA-HPA023396.100
Protein function: Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals. Dephosphorylates and activates transcription factor NFATC1. Dephosphorylates and inactivates transcription factor ELK1. Dephosphorylates DARPP32....
Schlagworte: | Anti-CALNA3, Anti-PPP3CC, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
Anwendung: | ICC, IHC, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 239,00 €

Artikelnummer: ATA-APrEST95711.100
PrEST Antigen PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma, Alternative Gene Names: CALNA3, PP2Bgamma, Antigen sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Calcium-dependent,...
Schlagworte: | PPP3CC, CALNA3, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent... |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €

Artikelnummer: CSB-PA018574GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
Schlagworte: | Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
Anwendung: | ELISA, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
552,00 €

Artikelnummer: CSB-PA018574ESR2HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
Schlagworte: | Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
Anwendung: | ELISA, WB, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, rat |
ab 167,00 €

Artikelnummer: CSB-PA018574ESR1HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
Schlagworte: | Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
Anwendung: | ELISA, WB, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, rat |
ab 167,00 €

Artikelnummer: CSB-CL018574HU.10
Length: 1539 Sequence: atgtccggga ggcgcttcca cctctccacc accgaccgcg tcatcaaagc tgtccccttt cctccaaccc aacggcttac tttcaaggaa gtatttgaga atgggaaacc taaagttgat gttttaaaaa accatttggt aaaggaagga cgactggaag aggaagtagc cttaaagata atcaatgatg gggctgccat cctgaggcaa gagaagacta tgatagaagt agatgctcca atcacagtat gtggtgatat...
Schlagworte: | CALNA3, PPP3CC, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent... |
Anwendung: | Molecular biology, clone |
Spezies-Reaktivität: | human |
357,00 €

Artikelnummer: G-AEFI00086.96
ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 0.156-10µg/mL. Sensitivity: 0.094µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the...
Schlagworte: | CALNA3, PPP3CC, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent... |
Anwendung: | Sandwich ELISA, Double Antibody |
Spezies-Reaktivität: | human |
641,00 €

Artikelnummer: VHPS-7178
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: | CALNA3, PPP3CC, EC=3.1.3.16, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit,... |
Anwendung: | RNA quantification |
44,00 €