Zu "GeneID 2983" wurden 18 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-GUCY1B1
Artikelnummer: ATA-HPA077706.100
Polyclonal Antibody against Human GUCY1B1, Gene description: guanylate cyclase 1 soluble subunit beta 1, Alternative Gene Names: GC-S-beta-1, GC-SB3, GUC1B3, GUCY1B3, Validated applications: ICC, Uniprot ID: Q02153, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Schlagworte: | Anti-GUC1B3, Anti-GCS-beta-3, Anti-GCS-beta-1, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
477,00 €
Anti-GUCY1B3
Artikelnummer: CSB-PA002672.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
126,00 €
Anti-GUCY1B3
Artikelnummer: CSB-PA214476.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
| Anwendung: | ELISA, WB, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
283,00 €
Anti-Guanylyl Cyclase beta
Artikelnummer: ARG59608.100
Protein function: Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP. [The UniProt Consortium]
| Schlagworte: | Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse, rat |
658,00 €
Anti-GUCY1B3
Artikelnummer: ATA-HPA020870.100
Protein function: Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 100% and to rat: 100%
| Schlagworte: | Anti-GUC1B3, Anti-GCS-beta-3, Anti-GCS-beta-1, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 320,00 €
Human GUCY1b3 (Guanylate Cyclase 1 Beta 3) ELISA Kit
Artikelnummer: ELK-ELK4914.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human GUCY1b3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human GUCY1b3....
| Schlagworte: | GUC1B3, GCS-beta-3, GCS-beta-1, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble subunit beta-3,... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
ab 374,00 €
GUCY1B1 (human), recombinant protein
Artikelnummer: ABS-PP-4473.100
| Schlagworte: | Guanylate cyclase soluble subunit beta-1, GCS-beta-1, Guanylate cyclase soluble subunit beta-3, GCS-beta-3, Soluble... |
| MW: | 24 kD |
ab 90,00 €
GUCY1B1 PrEST Antigen
Artikelnummer: ATA-APrEST95569.100
PrEST Antigen GUCY1B1, Gene description: guanylate cyclase 1 soluble subunit beta 1, Alternative Gene Names: GC-S-beta-1, GC-SB3, GUC1B3, GUCY1B3, Antigen sequence: ISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDL, Storage: Upon delivery...
| Schlagworte: | GUC1B3, GCS-beta-1, GCS-beta-3, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble subunit beta-1,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €
Anti-GUCY1B3
Artikelnummer: CSB-PA010052GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: GUCY1B1. Antigen Species: Human
| Schlagworte: | Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
| Anwendung: | ELISA, WB, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
552,00 €
GUCY1B3, Human guanylate cyclase 1, soluble, beta 3, Real...
Artikelnummer: VHPS-3930
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | GUC1B3, GUCY1B3, EC=4.6.1.2, GCS-beta-1, GCS-beta-3, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble... |
| Anwendung: | RNA quantification |
44,00 €
Anti-Guanylate Cyclase beta-1, Soluble (GCS-beta-1,...
Artikelnummer: G9804-50B.200
Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha and a beta subunit, catalyzes the conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide and nitrovasodilator drugs. Applications: Suitable for use in ELISA and Western Blot. Other...
| Schlagworte: | EC=4.6.1.2, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase soluble subunit beta-3, Anti-Guanylate... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
767,00 €
Guanylate Cyclase 1 Beta 3 (GUCY1b3) BioAssay(TM) ELISA...
Artikelnummer: 152637.96
Guanylate Cyclase 1 Beta 3 (GUCY1b3) BioAssay(TM) ELISA Kit (Human) is a Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Guanylate Cyclase 1 Beta 3 (GUCY1b3). Standards or samples are then added to the appropriate microtiter plate wells with a...
| Schlagworte: | GUC1B3, GUCY1B3, GCS-beta-1, GCS-beta-3, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble subunit... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
1.022,00 €