Zu "GeneID 215274" wurden 12 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
IL-1F10 Protein, Mouse, Recombinant (His & SUMO)
Artikelnummer: TGM-TMPH-02737-100ug
Description: IL-1F10 Protein, Mouse, Recombinant (His & SUMO) is expressed in E. coli.
| Schlagworte: | Interleukin-1 family member 10, Il1f10 |
| MW: | 33.1 kD |
ab 352,00 €
Interleukin-1 family member 10 (Il1f10), mouse, recombinant
Artikelnummer: CSB-YP837144MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 1-152aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MCSLPMARYY IIKDAHQKAL YTRNGQLLLG DPDSDNYSPE KVCILPNRGL DRSKVPIFLG MQGGSCCLAC VKTREGPLLQ LEDVNIEDLY KGGEQTTRFT FFQRSLGSAF RLEAAACPGW FLCGPAEPQQ PVQLTKESEP...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse Interleukin-1 family member 10 (Il1f10) |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | mouse |
| MW: | 19.1 kD |
ab 283,00 €
Interleukin-1 family member 10 (Il1f10), mouse, recombinant
Artikelnummer: CSB-EP837144MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 1-152aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MCSLPMARYY IIKDAHQKAL YTRNGQLLLG DPDSDNYSPE KVCILPNRGL DRSKVPIFLG MQGGSCCLAC VKTREGPLLQ LEDVNIEDLY KGGEQTTRFT FFQRSLGSAF RLEAAACPGW FLCGPAEPQQ...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse Interleukin-1 family member 10 (Il1f10) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 33.1 kD |
ab 354,00 €
IL-38, Mouse
Artikelnummer: CR-C02041-100UG
Sequence: MCSLPMARYY IIKDAHQKAL YTRNGQLLLG DPDSDNYSPE KVCILPNRGL DRSKVPIFLG MQGGSCCLAC VKTREGPLLQ LEDVNIEDLY EQTTRFTFFQ RSLGSAFRLE AAACPGWFLC GPAEPQQPVQ LTKESEPSTH with polyhistidine tag at the C-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Cytokine with...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
ab 108,00 €
Mouse IL1F10 ELISA Kit
Artikelnummer: ARG82064.96
Protein function: Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
1.056,00 €
IL-38 (aa 3-152) (mouse) (monomeric):Fc-KIH (human) (rec.)
Artikelnummer: AG-40B-0227-3010
IL-38 (IL-1F10) belongs to the IL-1 family of proteins. IL-38 is expressed in heart, placenta, fetal liver, spleen, thymus and tonsil. The expression in a variety of immune tissues and similarity to IL-1Ra suggest a role of IL-38 in the inflammatory response. It has been reported that removal of the N-terminus...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| Anwendung: | Bioassays |
| Exprimiert in: | Human cells |
| Ursprungsart: | mouse |
| MW: | ~52+28 kD |
ab 429,00 €
Mouse IL-38 Recombinant Protein (N-His)
Artikelnummer: G-RPES6706.20
Protein function: Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T- cells in response to heat-killed Candida albicans. Reduces IL36G- induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
395,00 €
Interleukin-38 (IL-38), (mouse, rec.), (FLAG)
Artikelnummer: AG-40B-0101-C010
IL-38 [IL-1F10] (mouse) (aa 3-152) is fused at the C-terminus o a FLAG®-tag. IL-38 (IL-1F10) mRNA is expressed in heart, placenta, fetal liver, spleen, thymus and tonsil. The expression in a variety of immune tissues and similarity to IL-1Ra suggest a role of IL-1F10 in the inflammatory response.
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| Anwendung: | Bioassays |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 20 kD |
ab 352,00 €
Il1F10, Mouse interleukin 1 family, member 10, Real Time...
Artikelnummer: VMPS-3073
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Il1f10, Interleukin 1 family, member 10 |
| Anwendung: | RNA quantification |
43,00 €
Il1f10, Recombinant, Mouse, aa1-152, His-SUMO-Tag...
Artikelnummer: 373808.20
Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| MW: | 33,1 |
ab 537,00 €
Il1f10, Recombinant, Mouse, aa1-152, His-Tag...
Artikelnummer: 373809.100
Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| MW: | 19,1 |
ab 606,00 €
IL-38 protein(N-His) (recombinant mouse)
Artikelnummer: E-PKSM041483.100
Sequence: MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Cytokine with immunomodulatory...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse IL-38 protein(N-His) |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 17.9 kD |
ab 295,00 €