IL33, Recombinant, Porcine (Sus Scrofa), aa123-276, GST-Tag (Interleukin-33)

Source:, Recombinant protein corresponding to aa123-276 from porcine (Sus Scrofa) IL-33, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~44.6kD, AA Sequence: EHSASLSTYNDQYITFAFEDGSYEIYVEDLRKDQEKDKVLLRYYDSQIPSSETDGGGDHRKLMVNLSPTKDKDFLLHANSKEHSVELQKCENPLPEQAFFVLHEQPSKCVSFECKSHPGVFLGVKNNQLALIKLGEHPEDSNRENTTFKLSNLM, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.