Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
---|---|---|---|---|---|---|---|
E-PKSS000004.5 | 5 µg | - |
7 - 16 Werktage* |
234,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect... mehr
Produktinformationen "IL-4 protein(N-His)(active) (recombinant swine)"
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.6 ng/mL. Sequence: MGLTSQLIPTLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC. Fusion tag: N-His Endotoxin: Please contact us for more information. Protein function: Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4. [The UniProt Consortium]
Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1, Recombinant Swine IL-4 protein(N-His)(active) |
Hersteller: | Elabscience |
Hersteller-Nr: | E-PKSS000004 |
Eigenschaften
Anwendung: | Active, cell culture |
Konjugat: | No |
Wirt: | E.coli |
Spezies-Reaktivität: | swine |
MW: | 15.85 kD |
Format: | Lyophilized |
Datenbank Information
KEGG ID : | K05430 | Passende Produkte |
UniProt ID : | Q04745 | Passende Produkte |
Gene ID | GeneID 397225 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | -80°C |
Versand: | +4°C (International: -20°C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "IL-4 protein(N-His)(active) (recombinant swine)"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen