Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
---|---|---|---|---|---|---|---|
298487.100 | 100 µg | - | - |
3 - 19 Werktage* |
916,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
The protein encoded by this gene mediates transcriptional control by interaction with the... mehr
Produktinformationen "TRIM28, Recombinant, Human, aa685-815, His-Tag (Tripartite Motif Containing 28, KRIP-1, KAP-1, TIF1-"
The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa685-815 from human bromodomain TRIM28, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.6kD, AA Sequence: MHHHHHHDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPLHQLATDSTFSLDQ, PGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRF, FETRMNEAFGDTKFSAVLVEPPPM, Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Schlagworte: | KAP1, KAP-1, TRIM28, KRIP-1, TIF1-beta, EC=2.3.2.27, RING finger protein 96, KRAB-associated protein 1, Nuclear corepressor KAP-1, KRAB-interacting protein 1, E3 SUMO-protein ligase TRIM28, Tripartite motif-containing protein 28 |
Hersteller: | United States Biological |
Hersteller-Nr: | 298487 |
Eigenschaften
Konjugat: | No |
MW: | 15,6 |
Format: | Purified |
Datenbank Information
KEGG ID : | K08882 | Passende Produkte |
UniProt ID : | Q13263 | Passende Produkte |
Gene ID | GeneID 10155 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | -80°C |
Versand: | -80°C (International: °C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "TRIM28, Recombinant, Human, aa685-815, His-Tag (Tripartite Motif Containing 28, KRIP-1, KAP-1, TIF1-"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen