TDO2, Recombinant, Mouse, aa1-406, His-Tag (Tryptophan 2,3-Dioxygenase)

TDO2, Recombinant, Mouse, aa1-406, His-Tag (Tryptophan 2,3-Dioxygenase)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375519.20 20 µg - -

3 - 19 Werktage*

497,00 €
375519.100 100 µg - -

3 - 19 Werktage*

777,00 €
 
Incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards... mehr
Produktinformationen "TDO2, Recombinant, Mouse, aa1-406, His-Tag (Tryptophan 2,3-Dioxygenase)"
Incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards tryptamine and derivatives including D- and L-tryptophan, 5-hydroxytryptophan and serotonin. Source: Recombinant protein corresponding to aa1-406 from mouse TDO2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~49.8kD, AA Sequence: MSGCPFAGNSVGYTLKNVSMEDNEEDRAQTGVNRASKGGLIYGNYLQLEKILNAQELQSEVKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVIARMHRVVVIFKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQSLRVPYNRKHYRDNFGGDYNELLLKSEQEQTLLQLVEAWLERTPGLEPNGFNFWGKFEKNILKGLEEEFLRIQAKTDSEEKEEQMAEFRKQKEVLLCLFDEKRHDYLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDTLMTKWRYNHVCMVHRMLGTKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLVPRHWVPKMNPIIHKFLYTAEYSDSSYFSSDESD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: TO, Tdo, TDO, TRPO, Tryptophanase, Tryptophan pyrrolase, Tryptophan oxygenase, Tryptamin 2,3-dioxygenase, Tryptophan 2,3-dioxygenase
Hersteller: United States Biological
Hersteller-Nr: 375519

Eigenschaften

Konjugat: No
MW: 49,8
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "TDO2, Recombinant, Mouse, aa1-406, His-Tag (Tryptophan 2,3-Dioxygenase)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen