SMT3, Recombinant, S. cerevisiae, aa2-98, His-Tag (Ubiquitin-like Protein SMT3)

SMT3, Recombinant, S. cerevisiae, aa2-98, His-Tag (Ubiquitin-like Protein SMT3)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375342.20 20 µg - -

3 - 19 Werktage*

675,00 €
375342.100 100 µg - -

3 - 19 Werktage*

1.045,00 €
 
Not known, suppressor of MIF2 mutations.||Source:|Recombinant protein corresponding to aa2-98... mehr
Produktinformationen "SMT3, Recombinant, S. cerevisiae, aa2-98, His-Tag (Ubiquitin-like Protein SMT3)"
Not known, suppressor of MIF2 mutations. Source: Recombinant protein corresponding to aa2-98 from saccharomyces cerevisiae SMT3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.1kD, AA Sequence: SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SMT3, YDR510W, D9719.15, Ubiquitin-like protein SMT3
Hersteller: United States Biological
Hersteller-Nr: 375342

Eigenschaften

Konjugat: No
MW: 13,1
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SMT3, Recombinant, S. cerevisiae, aa2-98, His-Tag (Ubiquitin-like Protein SMT3)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen