Riboflavin-binding Protein, Recombinant, Chicken, aa18-225, His-Tag

Riboflavin-binding Protein, Recombinant, Chicken, aa18-225, His-Tag
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375061.20 20 µg - -

3 - 19 Werktage*

675,00 €
375061.100 100 µg - -

3 - 19 Werktage*

1.045,00 €
 
Required for the transport of riboflavin to the developing oocyte.||Source:|Recombinant protein... mehr
Produktinformationen "Riboflavin-binding Protein, Recombinant, Chicken, aa18-225, His-Tag"
Required for the transport of riboflavin to the developing oocyte. Source: Recombinant protein corresponding to aa18-225 from chicken, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.8kD, AA Sequence: QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Hersteller: United States Biological
Hersteller-Nr: 375061

Eigenschaften

Konjugat: No
MW: 25,8
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Riboflavin-binding Protein, Recombinant, Chicken, aa18-225, His-Tag"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen