POL30, Recombinant, Saccharomyces Cerevisiae, aa1-258, His-Tag (Proliferating Cell Nuclear Antigen)

POL30, Recombinant, Saccharomyces Cerevisiae, aa1-258, His-Tag (Proliferating Cell Nuclear Antigen)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374781.20 20 µg - -

3 - 19 Werktage*

675,00 €
374781.100 100 µg - -

3 - 19 Werktage*

1.045,00 €
 
This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of... mehr
Produktinformationen "POL30, Recombinant, Saccharomyces Cerevisiae, aa1-258, His-Tag (Proliferating Cell Nuclear Antigen)"
This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Involved in DNA repair. Source: Recombinant protein corresponding to aa1-258 from saccharomyces cerevisiae POL30, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~30.9kD, AA Sequence: MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PCNA, POL30, YBR0811, YBR088C, Proliferating cell nuclear antigen
Hersteller: United States Biological
Hersteller-Nr: 374781

Eigenschaften

Konjugat: No
MW: 30,9
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "POL30, Recombinant, Saccharomyces Cerevisiae, aa1-258, His-Tag (Proliferating Cell Nuclear Antigen)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen