Pla2g5, Recombinant, Mouse, aa21-137, His-SUMO-Tag (Calcium-dependent Phospholipase A2)

Pla2g5, Recombinant, Mouse, aa21-137, His-SUMO-Tag (Calcium-dependent Phospholipase A2)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374728.20 20 µg - -

3 - 19 Werktage*

575,00 €
374728.100 100 µg - -

3 - 19 Werktage*

855,00 €
 
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.... mehr
Produktinformationen "Pla2g5, Recombinant, Mouse, aa21-137, His-SUMO-Tag (Calcium-dependent Phospholipase A2)"
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L-alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. Source: Recombinant protein corresponding to aa21-137 from mouse Pla2g5, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.8kD, AA Sequence: GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Pla2g5, PLA2-10, Phospholipase A2 group V, Phosphatidylcholine 2-acylhydrolase 5
Hersteller: United States Biological
Hersteller-Nr: 374728

Eigenschaften

Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: mouse
MW: 29.8 kD
Reinheit: ?90% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Pla2g5, Recombinant, Mouse, aa21-137, His-SUMO-Tag (Calcium-dependent Phospholipase A2)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen