Mcpt4, Recombinant, Mouse, aa21-246, His-Tag (Mast Cell Protease 4)

Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-, -Ile-5' bond of angiotensin I and the 'Phe-20-, -Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-, -His-9' bond of angiotensin I and the 'Phe-4-, -Ala-5' and 'Tyr-10-, -Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing. Source: Recombinant protein corresponding to aa21-246 from mouse Mcpt4, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~27.1kD, AA Sequence: IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.