Mcpt4, Recombinant, Mouse, aa21-246, His-Tag (Mast Cell Protease 4)

Mcpt4, Recombinant, Mouse, aa21-246, His-Tag (Mast Cell Protease 4)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374167.20 20 µg - -

3 - 19 Werktage*

575,00 €
374167.100 100 µg - -

3 - 19 Werktage*

855,00 €
 
Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and... mehr
Produktinformationen "Mcpt4, Recombinant, Mouse, aa21-246, His-Tag (Mast Cell Protease 4)"
Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-, -Ile-5' bond of angiotensin I and the 'Phe-20-, -Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-, -His-9' bond of angiotensin I and the 'Phe-4-, -Ala-5' and 'Tyr-10-, -Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing. Source: Recombinant protein corresponding to aa21-246 from mouse Mcpt4, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~29.1kD, AA Sequence: IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Mcpt4, MSMCP, mMCP-4, Myonase, EC=3.4.21.-, Mast cell protease 4, Serosal mast cell protease
Hersteller: United States Biological
Hersteller-Nr: 374167

Eigenschaften

Konjugat: No
MW: 29,1
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Mcpt4, Recombinant, Mouse, aa21-246, His-Tag (Mast Cell Protease 4)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen