Lox, Recombinant, Rat, aa163-411, His-Tag (Protein-lysine 6-oxidase)

Lox, Recombinant, Rat, aa163-411, His-Tag (Protein-lysine 6-oxidase)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374067.20 20 µg - -

3 - 19 Werktage*

575,00 €
374067.100 100 µg - -

3 - 19 Werktage*

855,00 €
 
Responsible for the post-translational oxidative deamination of peptidyl lysine residues in... mehr
Produktinformationen "Lox, Recombinant, Rat, aa163-411, His-Tag (Protein-lysine 6-oxidase)"
Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Source: Recombinant protein corresponding to aa163-411 from rat Lox, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33kD, AA Sequence: DDPYNPYKYSDDNPYYNYYDTYERPRSGSRHRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDASTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYSNNVVRCEIRYTGHHAYASGCTISPY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Lox, Lysyl oxidase, Protein-lysine 6-oxidase
Hersteller: United States Biological
Hersteller-Nr: 374067

Eigenschaften

Konjugat: No
MW: 33
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Lox, Recombinant, Rat, aa163-411, His-Tag (Protein-lysine 6-oxidase)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen