Histone H1.0-A, Recombinant, Xenopus Laevis, aa1-194, His-SUMO-Tag (H1f0-a)

Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division (By similarity). Source: Recombinant protein corresponding to aa1-194 from zenopus laevis Histone H1.0-A, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~37kD, AA Sequence: MTENSAPAAKPRRSKASKKSTDHPKYSDMILDAVQAEKSRSGSSRQSIQKYIKNNYTVGENADSQIKLSIKRLVTSGTLKQTKGVGASGSFRLAKADEVKKPAKKPKKEIKKAVSPKKAAKPKKAAKSPAKAKKPKVAEKKVKKAPKKKPAPSPRKAKKTKTVRAKPVWASKAKKAKPSKPKAKASPKKSGRKK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.