Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-spe

Post-translational modifications of conserved N-terminal tail residues in histones regulate many aspects of chromosome activity. Mitotic phosphorylation of H3 Thr 3 occurs in prophase and dephosphorylation during anaphase. Haspin, a dual serine/threonine kinase, plays an important role in regulation of chromosome and spindle function during mitosis and meiosis via its function in phosphorylation of the threonine residue in the third position of histone 3 (Thr3). Source: Human GSG2 partial ORF (NP_114171, aa699-798, recombinant protein with GST-tag at N-terminal. Sequence: VFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK , Theoretical MW (kD): 36.63, Preparation Method: In vitro wheat germ expression system, Quality Control: 12.5% SDS-PAGE Stained with Coomassie Blue, Storage and Stability: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein.