Glp1r, Recombinant, Mouse, aa22-145, His-SUMO-Tag (Glucagon-like Peptide 1 Receptor)

Glp1r, Recombinant, Mouse, aa22-145, His-SUMO-Tag (Glucagon-like Peptide 1 Receptor)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
370628.20 20 µg - -

3 - 19 Werktage*

575,00 €
370628.100 100 µg - -

3 - 19 Werktage*

855,00 €
 
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G... mehr
Produktinformationen "Glp1r, Recombinant, Mouse, aa22-145, His-SUMO-Tag (Glucagon-like Peptide 1 Receptor)"
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Source: Recombinant protein corresponding to aa22-145 from partial mouse Glp1r, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. AA Sequence: GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Glp1r, GLP-1R, GLP-1-R, GLP-1 receptor, Glucagon-like peptide 1 receptor
Hersteller: United States Biological
Hersteller-Nr: 370628

Eigenschaften

Konjugat: No
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Glp1r, Recombinant, Mouse, aa22-145, His-SUMO-Tag (Glucagon-like Peptide 1 Receptor)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen