DNASE1L3, Recombinant, Human, aa21-305, GST-Tag (Deoxyribonuclease gamma)

DNASE1L3, Recombinant, Human, aa21-305, GST-Tag (Deoxyribonuclease gamma)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
373083.20 20 µg - -

3 - 19 Werktage*

575,00 €
373083.100 100 µg - -

3 - 19 Werktage*

855,00 €
 
Has DNA hydrolytic activity. Does not bind to actin. Cleaves chromatin DNA to nucleosomal... mehr
Produktinformationen "DNASE1L3, Recombinant, Human, aa21-305, GST-Tag (Deoxyribonuclease gamma)"
Has DNA hydrolytic activity. Does not bind to actin. Cleaves chromatin DNA to nucleosomal units. Source: Recombinant protein corresponding to aa21-305 from human DNASE1L3,  fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~60.4kD, AA Sequence: MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: LSD, DHP2, LS-DNase, DNase gamma, EC=3.1.21.-, DNase I-like 3, Liver and spleen DNase, Deoxyribonuclease gamma, Deoxyribonuclease I-like 3, DNase I homolog protein DHP2
Hersteller: United States Biological
Hersteller-Nr: 373083

Eigenschaften

Konjugat: No
MW: 60,4
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "DNASE1L3, Recombinant, Human, aa21-305, GST-Tag (Deoxyribonuclease gamma)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen