D-dopachrome Decarboxylase, Recombinant, Mouse, aa2-118, His-Tag (Ddt)

Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI). Source: Recombinant protein corresponding to aa2-118 from mouse D-dopachrome Decarboxylase, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.9kD, AA Sequence: PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.