Cystathionine beta-Synthase, Recombinant, Mouse, aa2-561, His-Tag (Cbs)

Cystathionine beta-Synthase, Recombinant, Mouse, aa2-561, His-Tag (Cbs)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
372969.20 20 µg - -

3 - 19 Werktage*

621,00 €
372969.100 100 µg - -

3 - 19 Werktage*

947,00 €
 
Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group... mehr
Produktinformationen "Cystathionine beta-Synthase, Recombinant, Mouse, aa2-561, His-Tag (Cbs)"
Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine (By similarity). Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons. Source: Recombinant protein corresponding to aa2-561 from mouse Cystathionine beta-Synthase, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~63.4kD, AA Sequence: PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: CBS, Beta-thionase, Serine sulfhydrase, Cystathionine beta-synthase
Hersteller: United States Biological
Hersteller-Nr: 372969

Eigenschaften

Konjugat: No
MW: 63,4
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Cystathionine beta-Synthase, Recombinant, Mouse, aa2-561, His-Tag (Cbs)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen