Collagen alpha-1(I) Chain, Recombinant, Rat, aa955-1207, His-Tag

Type I collagen is a member of group I collagen (fibrillar forming collagen). Source: Recombinant protein corresponding to aa955-1207 from rat Collagen alpha-1(I) Chain, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.4kD, AA Sequence: QRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.