CMA1, Recombinant, Macaca Fascicularis, aa22-247, His-SUMO-Tag (Chymase)

Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular domain matrix degradation, and regulation of gland secretion. Source: Recombinant protein corresponding to aa22-247 from macaca fascucularis CMA1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~41.1kD, AA Sequence: IIGGTECKPHSRPYMAYLEIVTSNGPSKSCGGFLIRRNFVLTAVHCAGRSITVTLGAHNITEKEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRYFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRLDAKPPAVFTRISHYRPWINKILQAN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.