Chymase, Recombinant, Mouse, aa22-146, His-Tag (Cma1)

Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion. Source: Recombinant protein corresponding to aa22-146 from mouse Chymase, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18kD, AA Sequence: IIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.