ATP6V0D1, Recombinant, Human, aa1-351, GST-Tag (V-type Proton ATPase Subunit d 1)

ATP6V0D1, Recombinant, Human, aa1-351, GST-Tag (V-type Proton ATPase Subunit d 1)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
372389.20 20 µg - -

3 - 19 Werktage*

511,00 €
372389.100 100 µg - -

3 - 19 Werktage*

773,00 €
 
Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible... mehr
Produktinformationen "ATP6V0D1, Recombinant, Human, aa1-351, GST-Tag (V-type Proton ATPase Subunit d 1)"
Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis. May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium. Source: Recombinant protein corresponding to aa1-351 from human ATP6V0D1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~67.3kD, AA Sequence: MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: p39, ATP6D, ATP6V0D1, V-ATPase subunit d 1, V-ATPase AC39 subunit, 32 kDa accessory protein, Vacuolar proton pump subunit d 1, V-type proton ATPase subunit d 1, V-ATPase 40 kDa accessory protein
Hersteller: United States Biological
Hersteller-Nr: 372389

Eigenschaften

Konjugat: No
MW: 67,3
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "ATP6V0D1, Recombinant, Human, aa1-351, GST-Tag (V-type Proton ATPase Subunit d 1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen