3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase, Recombinant, Mouse, aa700-860, His-Tag (HMGCR)

Transmembrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins. Source: Partial recombinant protein corresponding to aa700-860 of mouse 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.4kD, AA Sequence: GRGKTVVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.