Anti-SOD3 (Extracellular Superoxide Dismutase [Cu-Zn], EC-SOD, MGC20077)

Anti-SOD3 (Extracellular Superoxide Dismutase [Cu-Zn], EC-SOD, MGC20077)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
133697.100 100 µg - -

3 - 19 Werktage*

699,00 €
 
Superoxide Dismutases (SODs), originally identified as Indophenoloxidase (IPO), are enzymes that... mehr
Produktinformationen "Anti-SOD3 (Extracellular Superoxide Dismutase [Cu-Zn], EC-SOD, MGC20077)"
Superoxide Dismutases (SODs), originally identified as Indophenoloxidase (IPO), are enzymes that catalyze the conversion of naturally-occuring, but harmful, superoxide radicals into molecular oxygen and hydrogen peroxide. Superoxide Dismutases 3, SOD3, also known as extracellular (EC) SOD, is tetrameric glycoprotein with an apparent subunit molecular weight of about 30kD. Three isoenzymes of SOD have been identified and are functionally related but have very modest sequence homology. SOD3 shares 23%, 17% sequence identity with SOD1 and SOD2, respectively. SOD3 shares ~64% sequence homology with mouse and rat SOD3. Like SOD1, SOD3 binds one Cu2+ and Zn2+ ions per subunit but differs in sequence and tissue distribution. SOD3 is a secretory protein and is synthesized with a putative 18aa signal peptide preceding the 222aa in the mature SOD3. SOD3 is found in plasma, lymph, and synovial fluid as well as in tissues. SOD3 binds on the surface of endothelial cells through the heparan sulfate proteoglycan and eliminates the oxygen radicals from the NADP-dependent oxidative system of neutrophils. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGC, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 133697

Eigenschaften

Anwendung: ELISA, WB
Antikörper-Typ: Monoclonal
Klon: 5C3
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Partial recombinant corresponding to aa26-125 from human SOD3 (AAH14418) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SOD3 (Extracellular Superoxide Dismutase [Cu-Zn], EC-SOD, MGC20077)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen