Anti-SLC22A8

Anti-SLC22A8
%
Rabattaktion
Aktion:

Sichern Sie sich 30% Rabatt auf alle Primärantikörper von Arigo Biolaboratories!

*1
*1 Angebot gültig bis zum 16.12.2024
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Rabatt Preis
ARG40720.50 50 µl - -

6 - 14 Werktage*

30 %
520,00 €
364,00 €
 
Protein function: Plays an important role in the excretion/detoxification of endogenous and... mehr
Produktinformationen "Anti-SLC22A8"
Protein function: Plays an important role in the excretion/detoxification of endogenous and exogenous organic anions, especially from the brain and kidney. Involved in the transport basolateral of steviol, fexofenadine. Transports benzylpenicillin (PCG), estrone- 3-sulfate (E1S), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), p-amino-hippurate (PAH), acyclovir (ACV) and ochratoxin (OTA). [The UniProt Consortium]
Schlagworte: Anti-OAT3, Anti-hOAT3, Anti-SLC22A8, Anti-Organic anion transporter 3, Anti-Solute carrier family 22 member 8
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40720

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, cow, dog, rabbit)
Immunogen: Synthetic peptide around the middle region of Human SLC22A8. (within the following region: PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS)
MW: 60 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SLC22A8"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen