Anti-SLC13A5

Anti-SLC13A5
%
Rabattaktion
Aktion:

Sichern Sie sich 30% Rabatt auf alle Primärantikörper von Arigo Biolaboratories!

*1
*1 Angebot gültig bis zum 16.12.2024
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Rabatt Preis
ARG40274.50 50 µl - -

6 - 14 Werktage*

30 %
520,00 €
364,00 €
 
Protein function: High-affinity sodium/citrate cotransporter that mediates citrate entry into... mehr
Produktinformationen "Anti-SLC13A5"
Protein function: High-affinity sodium/citrate cotransporter that mediates citrate entry into cells. The transport process is electrogenic, it is the trivalent form of citrate rather than the divalent form that is recognized as a substrate. May facilitate the utilization of circulating citrate for the generation of metabolic energy and for the synthesis of fatty acids and cholesterol. [The UniProt Consortium]
Schlagworte: Anti-NACT, Anti-NaCT, Anti-SLC13A5, Anti-Na(+)/citrate cotransporter, Anti-Solute carrier family 13 member 5, Anti-Sodium-coupled citrate transporter, Anti-Sodium-dependent citrate transporter
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40274

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, cow, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the middle region of Human SLC13A5. (within the following region: CKAMTLCICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWF)
MW: 63 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SLC13A5"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen