Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
%
Rabattaktion
Aktion:
Sichern Sie sich 30% Rabatt auf alle Primärantikörper von Arigo Biolaboratories!
*1
*1 Angebot gültig bis zum 16.12.2024
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Rabatt | Preis |
---|---|---|---|---|---|---|---|---|
ARG40274.50 | 50 µl | - | - |
6 - 14 Werktage* |
30 %
|
520,00 €
364,00 € |
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Protein function: High-affinity sodium/citrate cotransporter that mediates citrate entry into... mehr
Produktinformationen "Anti-SLC13A5"
Protein function: High-affinity sodium/citrate cotransporter that mediates citrate entry into cells. The transport process is electrogenic, it is the trivalent form of citrate rather than the divalent form that is recognized as a substrate. May facilitate the utilization of circulating citrate for the generation of metabolic energy and for the synthesis of fatty acids and cholesterol. [The UniProt Consortium]
Schlagworte: | Anti-NACT, Anti-NaCT, Anti-SLC13A5, Anti-Na(+)/citrate cotransporter, Anti-Solute carrier family 13 member 5, Anti-Sodium-coupled citrate transporter, Anti-Sodium-dependent citrate transporter |
Hersteller: | Arigo Biolaboratories |
Hersteller-Nr: | ARG40274 |
Eigenschaften
Anwendung: | WB |
Antikörper-Typ: | Polyclonal |
Konjugat: | No |
Wirt: | Rabbit |
Spezies-Reaktivität: | human (Erwartet: mouse, rat, cow, dog, guinea pig, horse, rabbit) |
Immunogen: | Synthetic peptide around the middle region of Human SLC13A5. (within the following region: CKAMTLCICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWF) |
MW: | 63 kD |
Format: | Affinity Purified |
Datenbank Information
KEGG ID : | K14445 | Passende Produkte |
UniProt ID : | Q86YT5 | Passende Produkte |
Gene ID | GeneID 284111 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | -20°C |
Versand: | +4°C (International: °C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SLC13A5"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen