Anti-Pokemon / ZBTB7A

Anti-Pokemon / ZBTB7A
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31846 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Zinc finger and BTB domain-containing... mehr
Produktinformationen "Anti-Pokemon / ZBTB7A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Zinc finger and BTB domain-containing protein 7A, also called Pokemon and FBI-1, is a protein that in humans is encoded by the ZBTB7A gene. It has a critical oncosuppressive role in the prostate. Prostate-specific inactivation of ZBTB7A leads to a marked acceleration of PTEN loss-driven prostate tumorigenesis through bypass of PTEN loss-induced cellular senescence. It has been showed that ZBTB7A physically interacts with SOX9 and functionally antagonizes its transcriptional activity on key target genes such as MIA, which is involved in tumor cell invasion, and H19, a long noncoding RNA precursor for an RB-targeting microRNA. Inactivation of ZBTB7A in vivo leads to RB downregulation, bypass of PTEN loss-induced cellular senescence, and invasive prostate cancer. Notably, it has been also found that ZBTB7A is genetically lost, as well as downregulated at both the mRNA and protein levels, in a subset of human advanced prostate cancers. Therefore, ZBTB7A is identified as a context-dependent cancer gene that can act as an oncogene in some contexts but that also has oncosuppressive-like activity in PTEN-null tumors. Protein function: Plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals. Specifically represses the transcription of the CDKN2A gene. Efficiently abrogates E2F1- dependent CDKN2A transactivation/de-repression. Binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'. [The UniProt Consortium]
Schlagworte: Anti-FBI1, Anti-TIP21, Anti-FBI-1, Anti-ZBTB7A, Anti-Pokemon, Anti-Zinc finger protein 857A, Anti-HIV-1 1st-binding protein 1, Anti-TTF-I-interacting peptide 21, Anti-Factor binding IST protein 1, Anti-Leukemia/lymphoma-related factor, Pokemon Antibody /
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31846

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF of human ZBTB7A were used as the immunogen for the Pokemon antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Pokemon / ZBTB7A"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen