Anti-PDK1 (3-phosphoinositide-dependent Protein Kinase 1, hPDK1, PDPK1, MGC20087, MGC35290)

PDK1 or PDPK1 is a 63kD monomeric protein which is also known as Akt kinase. PDK1 is composed of a C-terminal PH (pleckstrin homology) domain and an N-terminal catalytic domain. In response to insulin or insulin-like growth factor, PDK1 phosphorylates PKB/Akt1 on threonine 308 and serine 473 in a phosphatidylinositol 3,4,5-triphosphate or phosphatidylinositol 3,4-biphosphate-dependent manner. Phosphatidylinositol 3,4,5-triphosphate or phosphatidylinositol 3,4-biphosphate binds to the PH domains of PKB and PDK1 resulting in the translocation of these proteins to the cell membrane and activation of PKB. PDK1 also phosphorylates the 70kD ribosomal protein S6 kinase at threonine 229, which is required for its activation. Thus, PDK1 acts upstream of PKB and has been shown to control signals for proliferation and apoptosis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.