Anti-OPRL1 / Nociceptin Receptor

Anti-OPRL1 / Nociceptin Receptor
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40156.50 50 µl - -

6 - 14 Werktage*

520,00 €
 
Protein function: G-protein coupled opioid receptor that functions as receptor for the endogenous... mehr
Produktinformationen "Anti-OPRL1 / Nociceptin Receptor"
Protein function: G-protein coupled opioid receptor that functions as receptor for the endogenous neuropeptide nociceptin. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling via G proteins mediates inhibition of adenylate cyclase activity and calcium channel activity. Arrestins modulate signaling via G proteins and mediate the activation of alternative signaling pathways that lead to the activation of MAP kinases. Plays a role in modulating nociception and the perception of pain. Plays a role in the regulation of locomotor activity by the neuropeptide nociceptin. [The UniProt Consortium]
Schlagworte: Anti-OOR, Anti-OPRL1, Anti-KOR-3, Anti-Nociceptin receptor, Anti-Orphanin FQ receptor, Anti-Kappa-type 3 opioid receptor
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40156

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Synthetic peptide around the C-terminal region of Human OPRL1. (within the following region: ALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKD)
MW: 41 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-OPRL1 / Nociceptin Receptor"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen