Anti-Monoamine Oxidase B / MAOB

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32040 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Monoamine oxidase B, also called MAO,... mehr
Produktinformationen "Anti-Monoamine Oxidase B / MAOB"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Monoamine oxidase B, also called MAO, BRAIN, is a protein that in humans is encoded by the MAOB gene. MAOB is a member of the flavin monoamine oxidase family. And it is mapped on Xp11.3. MAOB catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. Like MAOA, it also degrades dopamine. MAO-B is involved in the breakdown of dopamine, a neurotransmitter implicated in reinforcing and motivating behaviors as well as movement. MAO-B inhibition is, therefore, associated with enhanced activity of dopamine, as well as with decreased production of hydrogen peroxide, a source of reactive oxygen species. Protein function: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine. [The UniProt Consortium]
Schlagworte: Anti-MAOB, Anti-MAO-B, EC=1.4.3.4, Anti-Monoamine oxidase type B, Anti-Amine oxidase [flavin-containing] B, Monoamine Oxidase B Antibody / MAOB
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32040

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER of human MAOB were used as the immunogen for the MAOB antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Monoamine Oxidase B / MAOB"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen