Anti-Monoamine Oxidase A / MAOA

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32008 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Monoamine oxidase A is an enzyme that in... mehr
Produktinformationen "Anti-Monoamine Oxidase A / MAOA"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Monoamine oxidase A is an enzyme that in humans is encoded by the MAO-A gene. MAOA is an isozyme of monoamine oxidase which is also mapped on Xp11.3. MAOA degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the outer mitochondrial membrane. Mutation in MAOA results in monoamine oxidase deficiency, or Brunner syndrome. In humans, there is a 30-base repeat sequence repeated in one of several different numbers of times in the promoter region of the gene coding for MAOA. MAO-A levels in the brain as measured using positron emission tomography are elevated by an average of 34% in patients with major depressive disorder. Inhibition of MAOA prevented apoptosis, and serum starvation of cortical brain cells from Maoa-deficient mice resulted in reduced apoptosis compared with wildtype mice. Protein function: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine. [The UniProt Consortium]
Schlagworte: Anti-MAOA, Anti-MAO-A, EC=1.4.3.4, Anti-Monoamine oxidase type A, Anti-Amine oxidase [flavin-containing] A, Monoamine Oxidase A Antibody / MAOA
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32008

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER of human MAOA were used as the immunogen for the MAOA antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Monoamine Oxidase A / MAOA"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen