Anti-MDR1 / P Glycoprotein 1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40845.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Acts as a tumor suppressor in many tumor types, induces growth arrest or... mehr
Produktinformationen "Anti-MDR1 / P Glycoprotein 1"
Protein function: Acts as a tumor suppressor in many tumor types, induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. In cooperation with mitochondrial PPIF is involved in activating oxidative stress-induced necrosis, the function is largely independent of transcription. Induces the transcription of long intergenic non-coding RNA p21 (lincRNA-p21) and lincRNA- Mkln1. LincRNA-p21 participates in TP53-dependent transcriptional repression leading to apoptosis and seems to have an effect on cell-cycle regulation. Implicated in Notch signaling cross-over. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression. Isoform 2 enhances the transactivation activity of isoform 1 from some but not all TP53-inducible promoters. Isoform 4 suppresses transactivation activity and impairs growth suppression mediated by isoform 1. Isoform 7 inhibits isoform 1-mediated apoptosis. Regulates the circadian clock by repressing CLOCK-ARNTL/BMAL1- mediated transcriptional activation of PER2 (PubMed:24051492). [The UniProt Consortium]
Schlagworte: Anti-P53, Anti-TP53, Anti-Antigen NY-CO-13, Anti-Phosphoprotein p53, Anti-Tumor suppressor p53, Anti-Cellular tumor antigen p53
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40845

Eigenschaften

Anwendung: IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 621-650 of Human P Glycoprotein 1. (IYFKLVTMQTAGNEVELENAADESKSEIDA)
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MDR1 / P Glycoprotein 1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen