Anti-IL7R / CD127

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32384 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The interleukin-7 receptor, also known as... mehr
Produktinformationen "Anti-IL7R / CD127"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID). Protein function: Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP). [The UniProt Consortium]
Schlagworte: Anti-IL7R, Anti-CD127, Anti-IL-7RA, Anti-CDw127, Anti-IL-7R-alpha, Anti-IL-7R subunit alpha, Anti-IL-7 receptor subunit alpha, Anti-Interleukin-7 receptor subunit alpha, IL7R Antibody / CD127
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32384

Eigenschaften

Anwendung: WB, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ from IL7R alpha
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-IL7R / CD127"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen