Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
---|---|---|---|---|---|---|---|
NSJ-R32874 | 100 µg | - | - |
3 - 10 Werktage* |
755,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Interleukin-22 (IL-22), also known as... mehr
Produktinformationen "Anti-IL-22"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Interleukin-22 (IL-22), also known as ILTIF, is protein that in humans is encoded by the IL22 gene. IL-22 a member of a group of cytokines called the IL-10 family or IL-10 superfamily, a class of potent mediators of cellular inflammatory responses. Using FISH, the IL22 gene is mapped to chromosome 12q15, close to the IFNG and the herpesvirus saimiri-induced AK155 genes. IL-22 can contribute to immune disease through the stimulation of inflammatory responses, S100s and defensins. It also promotes hepatocyte survival in the liver and epithelial cells in the lung and gut similar to IL-10. In some contexts, the pro-inflammatory versus tissue-protective functions of IL-22 are regulated by the often co-expressed cytokine IL-17A. Protein function: Cytokine that contributes to the inflammatory response in vivo. [The UniProt Consortium]
Schlagworte: | Anti-IL22, Anti-IL-22, Anti-ILTIF, Anti-IL-TIF, Anti-Interleukin-22, Anti-Cytokine Zcyto18, Anti-IL-10-related T-cell-derived-inducible factor, IL-22 Antibody |
Hersteller: | NSJ Bioreagents |
Hersteller-Nr: | R32874 |
Eigenschaften
Anwendung: | WB |
Antikörper-Typ: | Polyclonal |
Konjugat: | No |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
Immunogen: | Amino acids DDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNA were used as the immunogen for the IL-22 antibody. |
Format: | Purified |
Datenbank Information
KEGG ID : | K05445 | Passende Produkte |
UniProt ID : | Q9GZX6 | Passende Produkte |
Gene ID | GeneID 50616 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | +4°C |
Versand: | +4°C (International: +4°C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-IL-22"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
-30 %
Rabattaktion
Zuletzt angesehen