Anti-IL-22

Anti-IL-22
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32874 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Interleukin-22 (IL-22), also known as... mehr
Produktinformationen "Anti-IL-22"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Interleukin-22 (IL-22), also known as ILTIF, is protein that in humans is encoded by the IL22 gene. IL-22 a member of a group of cytokines called the IL-10 family or IL-10 superfamily, a class of potent mediators of cellular inflammatory responses. Using FISH, the IL22 gene is mapped to chromosome 12q15, close to the IFNG and the herpesvirus saimiri-induced AK155 genes. IL-22 can contribute to immune disease through the stimulation of inflammatory responses, S100s and defensins. It also promotes hepatocyte survival in the liver and epithelial cells in the lung and gut similar to IL-10. In some contexts, the pro-inflammatory versus tissue-protective functions of IL-22 are regulated by the often co-expressed cytokine IL-17A. Protein function: Cytokine that contributes to the inflammatory response in vivo. [The UniProt Consortium]
Schlagworte: Anti-IL22, Anti-IL-22, Anti-ILTIF, Anti-IL-TIF, Anti-Interleukin-22, Anti-Cytokine Zcyto18, Anti-IL-10-related T-cell-derived-inducible factor, IL-22 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32874

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids DDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNA were used as the immunogen for the IL-22 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-IL-22"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen