Anti-HSD3B2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59756.50 50 µl - -

6 - 14 Werktage*

551,00 €
 
Protein function: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of... mehr
Produktinformationen "Anti-HSD3B2"
Protein function: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. [The UniProt Consortium]
Schlagworte: Anti-HSD3B2, Anti-HSDB3B, EC=5.3.3.1, EC=1.1.1.145, Anti-3-beta-HSD II, Anti-Progesterone reductase, Anti-Steroid Delta-isomerase, Anti-Delta-5-3-ketosteroid isomerase, Anti-3-beta-HSD adrenal and gonadal type
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59756

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, monkey (Erwartet: mouse, rat, bovine, dog, goat, guinea pig, horse, sheep)
Immunogen: Synthetic peptide around the N-terminal region of Human HSD3B2. (within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN)
MW: 42 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-HSD3B2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen