Anti-FABP5

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58575.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Intracellular carrier for long-chain fatty acids and related active lipids,... mehr
Produktinformationen "Anti-FABP5"
Protein function: Intracellular carrier for long-chain fatty acids and related active lipids, such as the endocannabinoid, that regulates the metabolism and actions of the ligands they bind (PubMed:8608126, PubMed:12540600). In addition to the cytosolic transport, selectively delivers specific fatty acids from the cytosol to the nucleus, wherein they activate nuclear receptors. Delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta, which promotes proliferation and survival (PubMed:17512406). May also serve as a synaptic carrier of endocannabinoid at central synapses and thus controls retrograde endocannabinoid signaling (PubMed:29531087). Modulates inflammation by regulating PTGES induction via NF-kappa- B activation, and prostaglandin E2 (PGE2) biosynthesis during inflammation (PubMed:29440395). May be involved in keratinocyte differentiation. [The UniProt Consortium]
Schlagworte: Anti-Fabp5, Anti-Fabpe, Anti-E-FABP, Anti-PA-FABP, Anti-Fatty acid-binding protein 5, Anti-Keratinocyte lipid-binding protein, Anti-Fatty acid-binding protein, epidermal, Anti-Epidermal-type fatty acid-binding protein
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58575

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Mouse FABP5. (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD)
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FABP5"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen