Anti-EpCAM

Anti-EpCAM
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32527 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Epithelial cell adhesion molecule (EpCAM)... mehr
Produktinformationen "Anti-EpCAM"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cellûcell adhesion in epithelia. This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. Protein function: May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E. [The UniProt Consortium]
Schlagworte: Anti-KSA, Anti-EGP, Anti-CD326, Anti-EPCAM, Anti-Ep-CAM, Anti-EGP314, Anti-hEGP314, Anti-GA733-2, Anti-KS 1/4 antigen, Anti-Epithelial glycoprotein, Anti-Epithelial glycoprotein 314, Anti-Epithelial cell surface antigen, EpCAM Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32527

Eigenschaften

Anwendung: WB, IHC (paraffin), ELISA (protein)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids 147-189 (ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN) from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-EpCAM"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen