Anti-CYP3A4

Anti-CYP3A4
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32523 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Cytochrome P450 3A4 (abbreviated CYP3A4),... mehr
Produktinformationen "Anti-CYP3A4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Cytochrome P450 3A4 (abbreviated CYP3A4), is an important enzyme in the body, mainly found in the liver and in the intestine. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs in use today, including acetaminophen, codeine, cyclosporin A, diazepam and erythromycin. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist, however, it is now thought that this sequence represents a transcript variant of CYP3A4. Alternatively spliced transcript variants encoding different isoforms have been identified. Protein function: Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It performs a variety of oxidation reactions (e.g. caffeine 8-oxidation, omeprazole sulphoxidation, midazolam 1'-hydroxylation and midazolam 4- hydroxylation) of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,8-cineole 2- exo-monooxygenase. The enzyme also hydroxylates etoposide (PubMed:11159812). Catalyzes 4-beta-hydroxylation of cholesterol. May catalyze 25-hydroxylation of cholesterol in vitro (PubMed:21576599). Catalyzes sulfoxidation of the anthelmintics albendazole and fenbendazole (PubMed:10759686). [The UniProt Consortium]
Schlagworte: Anti-CYP3A3, Anti-CYP3A4, Anti-CYPIIIA3, Anti-CYPIIIA4, EC=1.14.14.-, Anti-Nifedipine oxidase, Anti-Cytochrome P450 HLp, Anti-Cytochrome P450 3A4, Anti-Cytochrome P450 3A3, Anti-Cytochrome P450-PCN1, Anti-Cytochrome P450 NF-25, CYP3A4 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32523

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids 237-277 (NICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMID) from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CYP3A4"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen