Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Aktion:
Sichern Sie sich 30% Rabatt auf alle Primärantikörper von Arigo Biolaboratories!
*1
*1 Angebot gültig bis zum 16.12.2024
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Rabatt | Preis |
---|---|---|---|---|---|---|---|---|
ARG58314.50 | 50 µg | - | - |
6 - 14 Werktage* |
30 %
|
520,00 €
364,00 € |
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Protein function: Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1)... mehr
Produktinformationen "Anti-Cyclin T1"
Protein function: Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor B (P-TEFb), which is proposed to facilitate the transition from abortive to productive elongation by phosphorylating the CTD (carboxy-terminal domain) of the large subunit of RNA polymerase II (RNA Pol II). [The UniProt Consortium]
Schlagworte: | Anti-CCNT1, Anti-CycT1, Anti-Cyclin-T, Anti-Cyclin-T1 |
Hersteller: | Arigo Biolaboratories |
Hersteller-Nr: | ARG58314 |
Eigenschaften
Anwendung: | IHC (paraffin), WB |
Antikörper-Typ: | Polyclonal |
Konjugat: | No |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat (Erwartet: bovine) |
Immunogen: | Synthetic peptide corresponding to a sequence in the middle region of Human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM), different from the related Mouse sequence by one amino acid |
MW: | 81 kD |
Format: | Antigen Affinity Purified |
Datenbank Information
KEGG ID : | K15188 | Passende Produkte |
UniProt ID : | O60563 | Passende Produkte |
Gene ID : | GeneID 904 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | -20°C |
Versand: | +4°C (International: °C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Cyclin T1"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen