Anti-CRP / C-Reactive Protein

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4555 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. C Reactive Protein (CRP) is a major acute... mehr
Produktinformationen "Anti-CRP / C-Reactive Protein"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. C Reactive Protein (CRP) is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is composed of 5 identical, 21,500-molecular weight subunits. CRP mediates activities associated with preimmune nonspecific host resistance. CRP shows the strongest association with cardiovascular events. It is detectable on the surface of about 4% of normal peripheral blood lymphocytes. Acute phase reactant CRP is produced in the liver. Protein function: Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. [The UniProt Consortium]
Schlagworte: Anti-CRP, Anti-PTX1, CRP Antibody / C-Reactive Protein
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4555

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
Immunogen: Amino acids QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CRP / C-Reactive Protein"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen