Anti-CHRNA5

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58428.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: After binding acetylcholine, the AChR responds by an extensive change in... mehr
Produktinformationen "Anti-CHRNA5"
Protein function: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [The UniProt Consortium]
Schlagworte: Anti-CHRNA5, Anti-NACHRA5, Anti-Neuronal acetylcholine receptor subunit alpha-5
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58428

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence at the N-terminus of Human CHRNA5 (44-76aa AKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKF), different from the related Mouse sequence by five amino acids, and from the related Rat sequence by four amino acids
MW: 53 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CHRNA5"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen