Anti-CHRNA3

Anti-CHRNA3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4415 100 µg - -

3 - 10 Werktage*

772,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. After binding acetylcholine, Nicotinic... mehr
Produktinformationen "Anti-CHRNA3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 (CHRNA3) responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [UniProt] Protein function: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [The UniProt Consortium]
Schlagworte: Anti-CHRNA3, Anti-NACHRA3, Anti-Neuronal acetylcholine receptor subunit alpha-3, CHRNA3 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4415

Eigenschaften

Anwendung: WB, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD from the human protein were used as the immunogen for the CHRNA3 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CHRNA3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen