Anti-Cdk6

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32480 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Cell division protein kinase 6, also... mehr
Produktinformationen "Anti-Cdk6"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Cell division protein kinase 6, also called Plstire, is an enzyme that in humans is encoded by the CDK6 gene. The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. Radiation hybrid analysis and inclusion within a mapped clone place the CDK6 gene at 7q21. Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation and promotes G1/S transition. This gene also involved in initiation and maintenance of cell cycle exit during cell differentiation. It prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types. In addition, CDK6 plays a role in promoting the proliferation of beta-cells in pancreatic islets of Langerhans. Protein function: Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation, promotes G1/S transition. Phosphorylates pRB/RB1 and NPM1. Interacts with D-type G1 cyclins during interphase at G1 to form a pRB/RB1 kinase and controls the entrance into the cell cycle. Involved in initiation and maintenance of cell cycle exit during cell differentiation, prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types (e.g. erythroid and hematopoietic cells). Essential for cell proliferation within the dentate gyrus of the hippocampus and the subventricular zone of the lateral ventricles. Required during thymocyte development. Promotes the production of newborn neurons, probably by modulating G1 length. Promotes, at least in astrocytes, changes in patterns of gene expression, changes in the actin cytoskeleton including loss of stress fibers, and enhanced motility during cell differentiation. Prevents myeloid differentiation by interfering with RUNX1 and reducing its transcription transactivation activity, but promotes proliferation of normal myeloid progenitors. Delays senescence. Promotes the proliferation of beta-cells in pancreatic islets of Langerhans. May play a role in the centrosome organization during the cell cycle phases (PubMed:23918663). [The UniProt Consortium]
Schlagworte: Anti-CDK6, Anti-CDKN6, EC=2.7.11.22, Anti-Cyclin-dependent kinase 6, Anti-Cell division protein kinase 6, Anti-Serine/threonine-protein kinase PLSTIRE, Cdk6 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32480

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Amino acids TETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Cdk6"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen