Anti-Cd46

Anti-Cd46
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31841 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD46 complement regulatory protein,also... mehr
Produktinformationen "Anti-Cd46"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD46 complement regulatory protein,also known as CD46 (cluster of differentiation 46) andMembrane Cofactor Protein,is aproteinwhich in humans is encoded by the CD46 gene. The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. And the encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described. Protein function: May be involved in the fusion of the spermatozoa with the oocyte during fertilization. [The UniProt Consortium]
Schlagworte: Anti-Mcp, Anti-Cd46, Anti-CD46, Anti-Membrane cofactor protein, Cd46 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31841

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse
Immunogen: Amino acids ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK of mouse Cd46 were used as the immunogen for the Cd46 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Cd46"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen