Anti-CD229 / Ly9

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4650 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. T-lymphocyte surface antigen Ly-9 is a... mehr
Produktinformationen "Anti-CD229 / Ly9"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. T-lymphocyte surface antigen Ly-9 is a protein that in humans is encoded by the LY9 gene. This gene is mapped to 17q21.31. LY9 has also recently been designated CD229 (cluster of differentiation 229). LY9 belongs to the SLAM family of immunomodulatory receptors and interacts with the adaptor molecule SAP. Protein function: Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. May participate in adhesion reactions between T lymphocytes and accessory cells by homophilic interaction. Promotes T-cell differentiation into a helper T-cell Th17 phenotype leading to increased IL-17 secretion, the costimulatory activity requires SH2D1A (PubMed:22184727). Promotes recruitment of RORC to the IL-17 promoter (PubMed:22989874). May be involved in the maintenance of peripheral cell tolerance by serving as a negative regulator of the immune response. May disable autoantibody responses and inhibit IFN-gamma secretion by CD4(+) T-cells. May negatively regulate the size of thymic innate CD8(+) T-cells and the development of invariant natural killer T (iNKT) cells. [The UniProt Consortium]
Schlagworte: Anti-LY9, Anti-CD229, Anti-SLAMF3, Anti-CDABP0070, Anti-Lymphocyte antigen 9, Anti-SLAM family member 3, Anti-Cell surface molecule Ly-9, Anti-T-lymphocyte surface antigen Ly-9, Anti-Signaling lymphocytic activation molecule 3, CD229 Antibody / Ly9
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4650

Eigenschaften

Anwendung: IHC (paraffin), FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CD229 / Ly9"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen