Anti-CD1b

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4547 100 µg - -

3 - 10 Werktage*

772,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD1b is a member of the CD1 family of... mehr
Produktinformationen "Anti-CD1b"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD1b is a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens. Protein function: Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells. [The UniProt Consortium]
Schlagworte: Anti-CD1B, Anti-CD1b, Anti-T-cell surface glycoprotein CD1b, CD1b Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4547

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids DKEVAELEEIFRVYIFGFAREVQDFAGDFQMKY
Format: Antigen Presentation

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CD1b"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen